PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019726m
Common NameEUTSA_v10019726mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 176aa    MW: 20548.1 Da    PI: 10.5135
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019726mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.91.3e-181153345
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      e+ + rqvt++kR++gi+K A+ELS+LCd+++ +++fs+ gk
  Thhalv10019726m 11 LESFTPRQVTYAKRKHGIIKTAKELSILCDVDIVLLMFSPVGK 53
                     678899**********************************997 PP

2K-box271.8e-101121692283
            K-box  22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                      + L+++++ Lq+ +     e  ++Ls+ +LqqLe+ L ksl +iR++K ++l  q ++ q +
  Thhalv10019726m 112 QVLREKVRFLQTHLS----ELHTRLSVDDLQQLENSLRKSLYRIRAHKVNMLQVQHQQDQFM 169
                      567888888888744....44489****************************9999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.315153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-22293IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-16323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-151553IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-163859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-6113164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGRVKLKIKK LESFTPRQVT YAKRKHGIIK TAKELSILCD VDIVLLMFSP VGKASLCCGK  60
HSIGEFIAKF AQLTPQERAK RKLETLEALK KTFMKLDHDV NIAEFLDRRN FQVLREKVRF  120
LQTHLSELHT RLSVDDLQQL ENSLRKSLYR IRAHKVNMLQ VQHQQDQFMS SECINQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391083.11e-127hypothetical protein EUTSA_v10019726mg, partial
SwissprotQ1PFA42e-61AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLV4KB741e-127V4KB74_EUTSA; Uncharacterized protein (Fragment)
STRINGBra004393.1-P8e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149561620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.14e-81AGAMOUS-like 94